missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody, Novus Biologicals™

Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody, Novus Biologicals™

Código de producto. 18681599 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18681599 25 μL 25 microlitros
18637998 100 μg 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18681599 Proveedor Novus Biologicals N.º de proveedor NBP26906325ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Polyclonal antibody specifically detects Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3
Aplicaciones Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen DKFZp761K2315, heparan sulfate 6-O-sulfotransferase 3
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 266722
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.