missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. FIP1/RCP Antibody, Novus Biologicals™

FIP1/RCP Antibody, Novus Biologicals™

Código de producto. 18466790 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18466790 0.1 mL 0.10 ml
18490031 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18466790 Proveedor Novus Biologicals N.º de proveedor NBP183600

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

FIP1/RCP Polyclonal antibody specifically detects FIP1/RCP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno FIP1/RCP
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50-1:200
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen DKFZp686E2214, EC 3.2.1.28, EC 6.1.1.7, FLJ22524, FLJ22622, MGC78448, NOEL1A, RAB11 coupling protein, RAB11 family interacting protein 1 (class I), rab11 family-interacting protein 1, Rab11-FIP1, Rab-coupling protein, Rab-interacting recycling protein, RCPRab effector protein
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: AKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDV
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 80223
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.