missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ FAM189B Recombinant Protein Antigen

Código de producto. 18225419 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18225419 0,1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18225419 Proveedor Novus Biologicals™ N.º de proveedor NBP188343PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM189B. The FAM189B Recombinant Protein Antigen is derived from E. coli. The FAM189B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-88343. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 10712
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen FAM189B
Tipo de etiqueta Unlabeled
Peso molecular 30kDa
Tipo de producto FAM189B
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88343. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno LLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGT
Mostrar más Mostrar menos

Para uso exclusivo en investigación

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.