missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. FAM188A Antibody, Novus Biologicals™

FAM188A Antibody, Novus Biologicals™

Código de producto. p-200047084 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18482941 25 μL 25 microlitros
18756473 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18482941 Proveedor Novus Biologicals N.º de proveedor NBP18854325ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Description

Rabbit Polyclonal Antibody

FAM188A Polyclonal specifically detects FAM188A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno FAM188A
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen C10orf97caspase recruitment domain containing pro-apoptotic protein, CARPRP11-394I23.1, chromosome 10 open reading frame 97, Dermal papilla-derived protein 5, DERP5CARD-containing protein, family with sequence similarity 188, member A, FLJ13397, MST126, my042, Protein CARP
Símbolos de los genes FAM188A
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGS
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 80013
Especificidad de la prueba Specificity of human FAM188A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.