missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Exosome Component 9 Antibody, R&D Systems™

Exosome Component 9 Antibody, R&D Systems™

Product Code. 18601057 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
25 μL
100 μL
Unit Size:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad Unit Size
18601057 25 μL 25 microlitros
18204194 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18601057 Supplier Novus Biologicals Supplier No. NBP25756525ul
 Artículo restringido
Fecha estimada de envoi: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Exosome Component 9 Polyclonal specifically detects Exosome Component 9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Exosome Component 9
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen Autoantigen PM/Scl 1, EC 3.1.13, exosome component 9Polymyositis/scleroderma autoantigen 75 kDa, p6, PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen, PMSCL175kD, Polymyositis/scleroderma autoantigen 1, polymyositis/scleroderma autoantigen 1 (75kD), polymyositis/scleroderma autoantigen 1, 75kDa
Símbolos de los genes EXOSC9
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITA
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 5393
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.