missing translation for 'onlineSavingsMsg'
Learn More

Dub3 Antibody, Novus Biologicals™

Código de producto. 18019513 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18019513 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18019513 Proveedor Novus Biologicals N.º de proveedor NBP179745

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Dub3 Polyclonal specifically detects Dub3 in Human samples. It is validated for Western Blot, Immunoprecipitation.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Dub3
Aplicaciones Western Blot, KnockDown
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml, KnockDown Validated
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen NP_958804
Alias de gen Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, DUB-3, DUB3deubiquitinating enzyme 3, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 17-like protein 2, ubiquitin specific peptidase 17-like 2, ubiquitin thioesterase 17-like protein 2, Ubiquitin thiolesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2
Símbolos de los genes USP17L2
Especie del huésped Rabbit
Inmunógeno Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL.
Peso molecular del antígeno 59 kDa
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 377630
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.