missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DAGLA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marca: Novus Biologicals NBP2-31856-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
DAGLA Polyclonal specifically detects DAGLA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| DAGLA | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9Y4D2 | |
| DAGLA | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL | |
| 25 μL | |
| Cellular Markers | |
| 747 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C11orf11, DAGL(ALPHA), DAGLALPHA, DGL-alpha, diacylglycerol lipase, alpha, EC 3.1.1.-, KIAA0659, Neural stem cell-derived dendrite regulator, NSDDRchromosome 11 open reading frame 11, sn1-specific diacylglycerol lipase alpha | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido