missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18671568

CD31/PECAM-1 Antibody, Novus Biologicals™

Código de producto. 18671568 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Cantidad:
25 μL
Tamaño de la unidad:
25 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18671568 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18671568 Proveedor Novus Biologicals N.º de proveedor NBP25552425ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

CD31/PECAM-1 Polyclonal specifically detects CD31/PECAM-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno CD31/PECAM-1
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:100 - 1:500
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen adhesion molecule, CD31, CD31 antigen, CD31/EndoCAM, EndoCAM, FLJ34100, FLJ58394, GPIIA', PECA1, PECAM-1, PECAM-1, CD31/EndoCAM, platelet endothelial cell adhesion molecule, platelet endothelial cell adhesion molecule-1, platelet/endothelial cell adhesion molecule
Símbolos de los genes PECAM1
Especie del huésped Rabbit
Inmunógeno This CD31/PECAM-1 Antibody was developed against a recombinant Protein corresponding to amino acids: APPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVL
Peso molecular del antígeno 82.5 kDa
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Angiogenesis, Cancer, Cellular Markers, Cytoskeleton Markers, Embryonic Stem Cell Markers, Endothelial Cell Markers, Extracellular Matrix, Hematopoietic Stem Cell Markers, Immunology, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Myeloid derived Suppressor Cell, Signal Transduction, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 5175
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.