missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
CCM2 Polyclonal antibody specifically detects CCM2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | CCM2 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.2) and 40% Glycerol |
| Alias de gen | C7orf22OSM, cerebral cavernous malformation 2, Cerebral cavernous malformations 2 protein, chromosome 7 open reading frame 22, malcavernin, MGC4067, MGC4607, MGC74868 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids: GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSR |
| Método de purificación | Immunogen affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?