missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
BLNK Polyclonal antibody specifically detects BLNK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | BLNK |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol |
| Alias de gen | AGM4, B cell linker protein, BASH, B-cell adapter containing a SH2 domain protein, B-cell adapter containing a Src homology 2 domain protein, B-cell linker, B-cell linker protein, BLNK-s, Cytoplasmic adapter protein, LY57, MGC111051, SLP-65BLNK-S, SLP65Ly57, Src homology 2 domain-containing leukocyte protein of 65 kDa |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the amino acids: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP |
| Método de purificación | Immunogen affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?