missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Biliverdin Reductase B/BLVRB Polyclonal specifically detects Biliverdin Reductase B/BLVRB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
Especificaciones
| Antígeno | Biliverdin Reductase B/BLVRB |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | Biliverdin reductase B, biliverdin reductase B (flavin reductase (NADPH)), Biliverdin-IX beta-reductase, BVR-B, EC 1.3.1.24, EC 1.5.1.30, flavin reductase, flavin reductase (NADPH), FLRBVRB, FR, GHBP, Green heme-binding protein, MGC117413, NADPH-dependent diaphorase, NADPH-flavin reductase, SDR43U1, short chain dehydrogenase/reductase family 43U, member 1 |
| Símbolos de los genes | BLVRB |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?