missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BHMT (Human) Recombinant Protein

Código de producto. 16192231
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16192231 10 μg 10 microgramos
16102241 25 μg 25 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16192231 Proveedor Abnova™ N.º de proveedor H00000635P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Human BHMT full-length ORF ( AAH12616, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ

Especificaciones

Número de acceso AAH12616
ID de gen (Entrez) 635
Nombre betaine-homocysteine methyltransferase
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Cantidad 10 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen BHMT
Especie Wheat Germ (in vitro)
Etiqueta de proteína GST
Tampón 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.