missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGAP11B Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-05582-100ul
Código de producto. 18652978
-
487.00€
459.90€ / 100 microlitros
Ahorro 27.10€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
ARHGAP11B Polyclonal antibody specifically detects ARHGAP11B in Human samples. It is validated for Western Blot
Especificaciones
| ARHGAP11B | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| B'-T, FAM7B1, Family With Sequence Similarity 7, Member B1, GAP (1-8), Rho GTPase Activating Protein 11B, Rho GTPase-Activating Protein 11B, Rho-Type GTPase-Activating Protein 11B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1). EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV | |
| 100 μg | |
| GPCR, Signal Transduction | |
| 89839 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido