missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ALG9 Antibody - Azide and BSA Free, Novus Biologicals™

ALG9 Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. p-200062065 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18608381 0.02 mL 0.02 ml
18663710 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18608381 Supplier Novus Biologicals Supplier No. NBP2923510.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ALG9 Polyclonal antibody specifically detects ALG9 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antígeno ALG9
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000
Formulación PBS with 50% glycerol, pH7.3.
Alias de gen alpha-1,2-mannosyltransferase ALG9, asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha 1,2mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha- 1,2-mannosyltransferase homolog (S.cerevisiae, alpha- 1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 9 homolog, CDG1L, DIBD1FLJ21845, disrupted in bipolar affective disorder 1, Disrupted in bipolar disorder protein 1, DKFZp586M2420, EC 2.4.1.-, LOH11CR1J, loss of heterozygosity, 11, chromosomal region 1 gene J product
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 439-618 of human ALG9 (NP_079016.2). LFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 79796
Especies diana Human
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.