missing translation for 'onlineSavingsMsg'
Learn More

AADACL4 Antibody, Novus Biologicals™

Código de producto. 18338860 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Unit Size:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18338860 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18338860 Supplier Novus Biologicals Supplier No. NBP191583

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

AADACL4 Polyclonal specifically detects AADACL4 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno AADACL4
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen NP_001013652
Alias de gen arylacetamide deacetylase-like 4
Símbolos de los genes AADACL4
Especie del huésped Rabbit
Inmunógeno Synthetic peptide directed towards the N terminal of human AADACL4. Peptide sequence FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG.
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 343066
Especificidad de la prueba Expected identity based on immunogen sequence: Canine: 100%; Pig: 91%; Rat: 84%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Equine, Guinea Pig, Rabbit
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.