UserName
Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.
Paris, France 01-05-2024
Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.
This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.
"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."
Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.
"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."
This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.
Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.
Questions? Reach Out to a Specialist >
Rabbit Polyclonal Antibody has been used in 2 publications
ID gene (immissione) | 55666 |
---|---|
Specie ospite | Rabbit |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Target Species | Human,Mouse,Rat |
Applicazioni | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Coniugato | Unconjugated |
Classificazione | Polyclonal |
Alias gene | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Isotype | IgG |
Test di specificità | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Antigene | NPLOC4 |
Metodo di purificazione | Affinity Purified |
Simboli geni | NPLOC4 |
Status giuridico | RUO |
Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Primario o secondario | Primary |
Rabbit Polyclonal Antibody has been used in 147 publications
Mouse Monoclonal Antibody
Rabbit Polyclonal Antibody has been used in 2 publications
ID gene (immissione) | 23476 |
---|---|
Specie ospite | Rabbit |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
Target Species | Human |
Coniugato | Unconjugated |
Classificazione | Polyclonal |
Alias gene | bromodomain containing 4, bromodomain-containing 4, CAPchromosome-associated protein, HUNK1bromodomain-containing protein 4, HUNKI, MCAP, Protein HUNK1 |
Isotype | IgG |
Test di specificità | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Antigene | BRD4 |
Metodo di purificazione | Affinity Purified |
Simboli geni | BRD4 |
Status giuridico | RUO |
Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Diluizione | Simple Western 1:60, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID:25616107). |
Primario o secondario | Primary |
Human Monoclonal Antibody
Rabbit Polyclonal Antibody has been used in 4 publications
Specie ospite | Rabbit |
---|---|
Immunogeno | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Target Species | Mouse,Rat |
Applicazioni | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Antigene | Factor VIII |
Metodo di purificazione | Affinity Purified |
Simboli geni | F8 |
Status giuridico | RUO |
Peso molecolare | MolecularWeight-theroretical: 19.9 kDa |
---|---|
ID gene (immissione) | 100144750 |
Simbolo del gene | TP-1 |
Proteine | IFN-tau-1 |
Purity or Quality Grade | >97 % pure by SDS-PAGE and HPLC |
Ricostituzione | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.) |
Concentrazione di endotossine | Less than 0.1 EU/μg of IFN-tau-1 AS determined by LAL method. |
Alias gene | Antiluteolysin, interferon tau-1, TP-1, Trophoblast antiluteolytic protein, Trophoblast protein 1, Trophoblastin |
Da utilizzare con (applicazione) | Bioactivity |
Formulazione | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Requisiti di stoccaggio | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
Human Monoclonal Antibody
ID gene (immissione) | 2572 |
---|---|
Specie ospite | Human |
Content And Storage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
Immunogeno | GAD65 |
N. accesso geni | Q05329 |
Target Species | Human |
Applicazioni | Flow Cytometry,ELISA,Functional Assay |
Coniugato | Unconjugated |
Classificazione | Monoclonal |
Alias gene | EC 4.1.1, EC 4.1.1.15, GAD-65, GAD65MGC161605, glutamate decarboxylase 2, glutamate decarboxylase 2 (pancreatic islets and brain, 65kD), glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa), Glutamate decarboxylase 65 kDa isoform, Glutamate decarboxylase-2 (pancreas), MGC161607,65 kDa glutamic acid decarboxylase |
Isotype | IgG1 |
Ricostituzione | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Forma | Purified |
Antigene | GAD2/GAD65 |
Metodo di purificazione | Protein A purified |
Status giuridico | RUO |
Formulazione | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Disciplina di ricerca | Diabetes Research, Immune System Diseases, Immunology, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience |
Primario o secondario | Primary |
Clone | U.Washington patent anti-GAD65 |
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Sinonimo | Double-stranded RNA |
---|---|
Product Type | ELISA Kit (Colorimetric) |
Da utilizzare con (applicazione) | ELISA |
Assay Sensitivity | 3 ng/ml |
Intervallo saggio | 1 - 300 ng/ml (0.1 - 30 ng/well) |
Requisiti di stoccaggio | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Specificità | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
Bersaglio | Multi-Species |
Rat Monoclonal Antibody
Highly purified and high bioactivity. Generating reliable and reproducible results.
ID gene (immissione) | 6622 |
---|---|
Immunogeno | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Coniugato | Unconjugated |
Alias gene | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
Simbolo del gene | SNCA |
Sorgente | E.Coli |
Cross-reattività | Human |
Product Type | Recombinant Protein |
Da utilizzare con (applicazione) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Metodo di purificazione | >95% pure by SDS-PAGE |
Status giuridico | RUO |
Nome | Human alpha-Synuclein Aggregate Protein |
Formulazione | PBS |
Recombinant | Recombinant |
Potencie sus procesos desde la PCR hasta la secuenciación.