missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human ZNF148 Partial ORF (NP_068799, 695 a.a. - 794 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human ZNF148 Partial ORF (NP_068799, 695 a.a. - 794 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16137855
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Pakningsstørrelse:
10µg
25µg
Denne vare kan ikke returneres. Se returpolicy
Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Used for AP, Array, ELISA, WB-Re

Sequence: NHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

Tekniske data

Accession Number NP_068799
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 7707
Molecular Weight (g/mol) 36.74kDa
Name ZNF148 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen NHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias BERF-1/BFCOL1/HT-BETA/ZBP-89/ZFP148/pHZ-52
Common Name ZNF148
Gene Symbol ZNF148
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel
Abnova™ Human ZNF148 Partial ORF (NP_068799, 695 a.a. - 794 a.a.) Recombinant Protein with GST-tag at N-terminal >

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.