missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SYNE1 Partial ORF (NP_892006, 1561 a.a. - 1670 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023345-Q01.25ug
This item is not returnable.
View return policy
Description
This gene encodes a spectrin repeat containing protein expressed in skeletal and smooth muscle, and peripheral blood lymphocytes, that localizes to the nuclear membrane. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia 8, also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Sequence: LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTWSpecifications
| NP_892006 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW | |
| RUO | |
| SYNE1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 23345 | |
| SYNE1 (Human) Recombinant Protein (Q01) | |
| 25 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 8B/CPG2/DKFZp781J13156/FLJ30878/FLJ41140/KIAA0796/KIAA1262/KIAA1756/MYNE1/SCAR8 | |
| SYNE1 | |
| Recombinant | |
| wheat germ expression system |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human SYNE1 Partial ORF (NP_892006, 1561 a.a. - 1670 a.a.) Recombinant Protein with GST-tag at N-terminal > 25μg
Spot an opportunity for improvement?Share a Content Correction