missing translation for 'onlineSavingsMsg'
Learn More

Tocris Bioscience™ [D-Ala2]-GIP (human)
GREENER_CHOICE

Código de producto. 18796556
Cambiar vista
Click to view available options
Cantidad:
1 mg
Tamaño de la unidad:
1 miligramo
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18796556 1 mg 1 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18796556 Proveedor Tocris Bioscience™ N.º de proveedor 6699/1

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Highly potent GIP agonist

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.
TRUSTED_SUSTAINABILITY

Especificaciones

Pureza 95%
CAS 444073-04-5
Contenido y almacenamiento Store at -20°C
Descripción GIP receptor agonist
Formulación C226H338N60O66S
Peso molecular 4983.58
Cantidad 1 mg
Secuencia YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala)
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.