missing translation for 'onlineSavingsMsg'
Learn More

vav 1 guanine nucleotide exchange factor, Mouse, Clone: 1A6, Abnova™

Código de producto. 16197385
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16197385 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16197385 Proveedor Abnova N.º de proveedor H00007409M02.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse monoclonal antibody raised against a partial recombinant VAV1.

The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. [provided by RefSeq

Sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Especificaciones

Antígeno vav 1 guanine nucleotide exchange factor
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Clon 1A6
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a partial recombinant VAV1.
Formulación PBS with no preservative; pH 7.4
génica VAV1
N.º de referencia del gen BC013361
Alias de gen VAV
Símbolos de los genes VAV1
Especie del huésped Mouse
Inmunógeno VAV1 (AAH13361, 681 a.a. ∼ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Método de purificación Affinity Purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Signal Transduction
Molécula completa Yes
Primario o secundario Primary
ID de gen (Entrez) 7409
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG2a κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.