missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16121955

nonmetastatic cells 1, protein (NM23A) expressed in, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Código de producto. 16121955
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16121955 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16121955 Proveedor Abnova N.º de proveedor H00004830D01P.100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit polyclonal antibody raised against a full-length human NME1 protein.

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Especificaciones

Antígeno non-metastatic cells 1, protein (NM23A) expressed in
Aplicaciones Immunofluorescence, Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Rabbit polyclonal antibody raised against a full-length human NME1 protein.
Formulación PBS with no preservative; pH 7.4
génica NME1
N.º de referencia del gen NM_198175
Alias de gen AWD/GAAD/NB/NBS/NDPK-A/NDPKA/NM23/NM23-H1
Símbolos de los genes NME1
Especie del huésped Rabbit
Inmunógeno NME1 (ENSP00000337060, 1 a.a. ∼ 177 a.a) full-length human protein.
Método de purificación Affinity Purified
Cantidad 100 μg
Estado normativo RUO
Disciplina de investigación Endocrine/Metabolism
Primario o secundario Primary
ID de gen (Entrez) 4830
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.