missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16108292

FGF21, Mouse, Clone: 1A8, Abnova™

Código de producto. 16108292
Cambiar vista
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad Tamaño de la unidad
16108292 100 μg 100 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16108292 Proveedor Abnova N.º de proveedor H00026291M02.100ug
 Artículo restringido
Fecha estimada de envoi: 07-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse monoclonal antibody raised against a full-length recombinant FGF21.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Especificaciones

Antígeno FGF21
Aplicaciones ELISA, Immunoprecipitation, Western Blot
Clasificación Monoclonal
Clon 1A8
Conjugado Unconjugated
Descripción Mouse monoclonal antibody raised against a full length recombinant FGF21.
Formulación PBS with no preservative; pH 7.4
génica FGF21
N.º de referencia del gen BC018404
Símbolos de los genes FGF21
Especie del huésped Mouse
Inmunógeno FGF21 (AAH18404, 30 a.a. ∼ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Método de purificación Unpurified
Cantidad 100 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 26291
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Isotype IgG1 κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.