missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 16190347

APOL4, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Código de producto. 16190347
Change view
Click to view available options
Cantidad:
50 μg
Tamaño de la unidad:
50 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16190347 50 μg 50 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16190347 Proveedor Abnova N.º de proveedor H00080832B01P.50ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse polyclonal antibody raised against a full-length human APOL4 protein.

The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq

Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV

Especificaciones

Antígeno APOL4
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Descripción Mouse polyclonal antibody raised against a full-length human APOL4 protein.
Formulación PBS with no preservative; pH 7.4
génica APOL4
N.º de referencia del gen ENST00000328429
Alias de gen APOL-IV/APOLIV
Símbolos de los genes APOL4
Especie del huésped Mouse
Inmunógeno APOL4 (ENSP00000331089, 1 a.a. ∼ 107 a.a) full-length human protein.
Método de purificación Affinity chromatography
Cantidad 50 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 80832
Especies diana Human
Contenido y almacenamiento Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Tipo de producto Antibody
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.