missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

PGC-1 beta Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18604792 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity Pakningsstørrelse
18604792 0.02 mL 0.02mL
18691622 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18604792 Leverandør Novus Biologicals Leverandørnr. NBP2942380.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternative produkter

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PGC-1 beta Polyclonal antibody specifically detects PGC-1 beta in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen PGC-1 beta
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp686C1790, ERRL1, PERCFLJ14284, peroxisome proliferator-activated receptor gamma, coactivator 1 beta, PGC1, PGC1Bgamma, coactivator 1, beta, PPARGC1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Chromatin Research, Diabetes Research, Hypoxia, Lipid and Metabolism, Mitochondrial Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 133522
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.