Resultados de la búsqueda filtrada
Los productos de algunos de nuestros proveedores no aparecen en los resultados de la búsqueda filtrada. Por favor,
borre todos los filtros
para ver estos productos.
1
–
15
de
944,361
resultados
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Protein G purified |
| Concentración | 0.9 mg/mL |
| Inmunógeno | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Dilución | Western Blot 1:500 |
| Formulario | Purified |
| Clon | XJ11-1B12 |
| Isotype | IgG1 κ |
| Símbolos de los genes | ESPL1 |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 9700 |
| Antígeno | Separase |
| N.º de referencia del gen | Q14674 |
| Disciplina de investigación | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Aplicaciones | Western Blot |
| Contenido y almacenamiento | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Alias de gen | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Monoclonal |
| Requisitos de almacenamiento | Store at -80C. Avoid freeze-thaw cycles. |
|---|---|
| Formulación | PBS pH 7.4 |
| Expresión | alpha-Synuclein |
| Símbolo de gen | SNCA |
| Alias de gen | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| ID de gen (Entrez) | 6622 |
| Categoría de investigación | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Grado de pureza o calidad | >95%, by SDS-PAGE |
| Para utilizar con (aplicación) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Alias de gen | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
|---|---|
| Símbolos de los genes | TP53BP1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Primario o secundario | Primary |
|---|---|
| Formulación | 0.2um-filtered solution in PBS, pH 7.4. |
| Método de purificación | Protein G purified |
| Concentración | 1 mg/mL |
| Inmunógeno | Recombinant Listeria monocytogenes p60. |
| Dilución | Western Blot, ELISA |
| Formulario | Purified |
| Clon | p6007 |
| Isotype | IgG1 κ |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| Antígeno | Listeria monocytogenes p60 |
| Aplicaciones | Western Blot,ELISA |
| Contenido y almacenamiento | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Alias de gen | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Especificidad de la prueba | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Especies diana | Bacteria |
| Estado normativo | RUO |
| Clasificación | Monoclonal |
GM130/GOLGA2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Concentración | 1.0 mg/mL |
| Inmunógeno | Partial recombinant human GM130/GOLGA2 protein (amino acids 528-606). [UniPro Q08379] |
| Dilución | Western Blot 0.5 ug/ml, Immunohistochemistry 1:1000 - 1:1500, Immunocytochemistry/Immunofluorescence 5 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:1500 |
| Isotype | IgG |
| Símbolos de los genes | GOLGA2 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 2801 |
| Antígeno | GM130/GOLGA2 |
| Disciplina de investigación | Cellular Markers, Golgi Apparatus Markers |
| Aplicaciones | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | 130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein |
| Especies diana | Human,Mouse |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Affinity Purified |
| Concentración | 1.0 mg/mL |
| Isotype | IgG |
| Símbolos de los genes | PAK1 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 5058 |
| Antígeno | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| N.º de referencia del gen | Q13153//Q13177//O75914 |
| Disciplina de investigación | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Aplicaciones | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Especies diana | Rat,Human,Mouse |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Isotype | IgG |
| Símbolos de los genes | RWDD4 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 201965 |
| Antígeno | RWDD4A |
| Aplicaciones | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Especificidad de la prueba | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human,Mouse,Rat |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
CaMKII alpha/beta, p Thr286, p Thr287 Antibody (22B1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 4 publications
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Protein G purified |
| Concentración | 1 mg/mL |
| Inmunógeno | Synthetic peptide |
| Dilución | Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting |
| Formulario | Purified |
| Clon | 22B1 |
| Isotype | IgG1 |
| Símbolos de los genes | CAMK2A |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 815 |
| Antígeno | CaMKII alpha/beta (p Thr286, p Thr287) |
| N.º de referencia del gen | P11275 |
| Disciplina de investigación | Phospho Specific, Wnt Signaling Pathway |
| Aplicaciones | Western Blot |
| Contenido y almacenamiento | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Alias de gen | calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain |
| Especificidad de la prueba | This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B). |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Monoclonal |
Bassoon Antibody (SAP7F407), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Protein G purified |
| Concentración | 1.0 mg/mL |
| Peso molecular del antígeno | 400 kDa |
| Inmunógeno | Recombinant rat Bassoon. |
| Dilución | Western Blot 1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:400, Immunoprecipitation 2.5 ug, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen |
| Formulario | Purified |
| Clon | SAP7F407 |
| Símbolos de los genes | BSN |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 8927 |
| Antígeno | Bassoon |
| N.º de referencia del gen | O88778 |
| Aplicaciones | Immunofluorescence,Immunohistochemistry,Immunocytochemistry,Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at -20C. Avoid freeze-thaw cycles. |
| Alias de gen | bassoon (presynaptic cytomatrix protein) |
| Especificidad de la prueba | This affinity purified detects an ∼400 kDa protein, corresponding to the apparent molecular mass of Bassoon on SDSPAGE immunoblots, in samples from mouse and rat origins. Additional bands between 97 and 400 kDa may also be detected. |
| Especies diana | Rat,Mouse |
| Estado normativo | RUO |
| Clasificación | Monoclonal |