missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. YY2 Antibody - Azide and BSA Free, R&D Systems™

YY2 Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18603160 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18603160 0.02 mL 0.02mL
18660751 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18603160 Leverandør Novus Biologicals Leverandørnr. NBP2939050.02ml
 Restricted Item
Fecha estimada de envoi: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

YY2 Polyclonal specifically detects YY2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen YY2
Applications ELISA, Immunocytochemistry/Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias transcription factor YY2, YY2 transcription factor, ZNF631
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Endocrinology
Primary or Secondary Primary
Gene ID (Entrez) 404281
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.