missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18604408

Glutathione Peroxidase 4/GPX4 Antibody, Novus Biologicals™

Product Code. 18604408 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18604408 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18604408 Supplier Novus Biologicals Supplier No. NBP25522025ul
 Restricted Item
Fecha estimada de envoi: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody has been used in 1 publication

Glutathione Peroxidase 4/GPX4 Polyclonal specifically detects Glutathione Peroxidase 4/GPX4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigen Glutathione Peroxidase 4/GPX4
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 1.11.1, EC 1.11.1.12, Glutathione peroxidase 4, glutathione peroxidase 4 (phospholipid hydroperoxidase), GPx-4, GSHPx-4, MCSP, PHGPxsnGPx, phospholipid hydroperoxidase, phospholipid hydroperoxide glutathione peroxidase, mitochondrial, snPHGPx, sperm nucleus glutathione peroxidase
Gene Symbols GPX4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2879
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.