missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EID1 Antibody, R&D Systems™

EID1 Antibody, R&D Systems™

Product Code. 18604526 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18604526 25 μL 25µL
18183119 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18604526 Supplier Novus Biologicals Supplier No. NBP24735525ul
 Restricted Item
Fecha estimada de envoi: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

EID1 Polyclonal specifically detects EID1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen EID1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 21 kDa pRb-associated protein, C15orf3PTD014, CREBBP/EP300 inhibitor 1, CREBBP/EP300 inhibitory protein 1MGC138884, CRI1EP300-interacting inhibitor of differentiation 1, E1A-like inhibitor of differentiation 1, EID-1MGC138883, EP300 interacting inhibitor of differentiation 1, IRO45620, NB4 apoptosis related protein, Rb- and p300-binding protein EID-1, RBP21, retinoblastoma protein-associated protein
Gene Symbols EID1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 23741
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.