missing translation for 'onlineSavingsMsg'
Learn More

ZNF347 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-80596

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18214377

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

ZNF347 Polyclonal specifically detects ZNF347 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

ZNF347
Polyclonal
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
zinc finger 1111, zinc finger protein 1111, zinc finger protein 347, ZNF1111
Rabbit
Affinity Purified
RUO
84671
Human
IgG
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
ZNF347
This antibody was developed against Recombinant Protein corresponding to amino acids:LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only