missing translation for 'onlineSavingsMsg'
Learn More

YWHAQ Recombinant Protein, Abnova

Marca:  Abnova H00010971-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16105952

  • 518.16€ / 25 microgramos
Envío estimado: 24-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH56867
Solution
10971
YWHAQ (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
YWHAQ
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
52.69
8
Glutathione Sepharose 4 Fast Flow
25 ug
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
14-3-3/1C5/HS1
YWHAQ
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales