missing translation for 'onlineSavingsMsg'
Learn More

WFDC2 Recombinant Protein, Abnova

Human full-length ORF recombinant protein with GST-tag at N-terminal

Marca:  Abnova H00010406-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195022

  • 458.00€ / 25 microgramos


Fecha estimada de envío
27-10-2020
Añadir a la cesta

Descripción

Descripción

  • Encoded by WAP four-disulfide core domain 2
  • Molecular weight: 36.08kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in elution buffer

Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH46106.1
Solution
10406
WFDC2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
WFDC2
Human
Yes
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
36.08
8
Glutathione Sepharose 4 Fast Flow
25 ug
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
HE4|MGC57529|WAP5|dJ461P17.6
WFDC2
Wheat Germ (in vitro)
GST
Videos
Documentos