missing translation for 'onlineSavingsMsg'
Learn More

UNQ6411 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-90648

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216007

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock



UNQ6411 Polyclonal specifically detects UNQ6411 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.


Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
C2orf66, chromosome 2 open reading frame 66, LOC401027
Affinity Purified
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
This antibody was developed against Recombinant Protein corresponding to amino acids:TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG
0.1 mL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos



Ofertas especiales

Ofertas especiales

For Research Use Only