missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ UBL3 (Human) Recombinant Protein

Human UBL3 full-length ORF ( AAH59385, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00005412-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199271

  • 458.00€ / 25 microgramos


Fecha estimada de envío
27-10-2020
Añadir a la cesta

Descripción

Descripción

  • Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Especificaciones

Especificaciones

AAH59385
ubiquitin-like 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
UBL3
GST
5412
Wheat germ expression system
25 μg
DKFZp434K151, FLJ32018, HCG-1, PNSC1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documentos