missing translation for 'onlineSavingsMsg'
Learn More

TRIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-84874

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18215448

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

TRIP1 Polyclonal specifically detects TRIP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

TRIP1
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
eIF-3-beta, eIF3-beta, eIF3i, eIF3-p36, EIF3S2TGF-beta receptor-interacting protein 1, Eukaryotic translation initiation factor 3 subunit 2, eukaryotic translation initiation factor 3 subunit I, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa, eukaryotic translation initiation factor 3, subunit I, predicted protein of HQ2242, TGFbeta receptor-interacting protein 1, TRIP-1, TRIP-1eIF3 p36, TRIP1PRO2242
Rabbit
Affinity Purified
RUO
Primary
Specificity of human TRIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
EIF3I
This antibody was developed against Recombinant Protein corresponding to amino acids:MGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRD
0.1 mL
Angiogenesis, Cancer, Core ESC Like Genes, Stem Cell Markers
8668
Human, Mouse, Rat
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only