Abnova™ TP53I3 Recombinant Protein

335.00€ - 508.00€

Número de acceso	AAH00474.1
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez)	9540
Peso molecular	62.26

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16103822 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00009540-P01.10UG	10 ug	335.00€ 10 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16113822 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00009540-P01.25UG	25 ug	508.00€ 25 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 05-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH00474.1
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	62.26
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	TP53I3
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	9540
Nombre	TP53I3 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Alias de gen	PIG3
Símbolo de gen	TP53I3
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Descripción