missing translation for 'onlineSavingsMsg'
Learn More

TMEM87A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-90531

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18215997

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

TMEM87A Polyclonal specifically detects TMEM87A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

TMEM87A
Polyclonal
Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
DKFZp564G2022, PSEC0094, transmembrane protein 87A
Rabbit
Affinity Purified
RUO
25963
Human
IgG
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
TMEM87A
This antibody was developed against Recombinant Protein corresponding to amino acids:TTIFLKFDGEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only