Abnova™ TMEM14A Recombinant Protein

Name: Abnova&trade; TMEM14A Recombinant Protein
Brand: Abnova&trade;
SKU: 16118912
Price: 508.00 EUR

Marca: Abnova™ H00028978-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16118912

Fecha estimada de envío: 29-05-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH15097
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	36.63
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Inmunógeno	MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
Alias de gen	C6orf73/PTD011
Símbolo de gen	TMEM14A
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	28978
Nombre	TMEM14A (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	TMEM14A
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Sugerencias de productos

Descripción