missing translation for 'onlineSavingsMsg'
Learn More

TMED3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-69575

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215861

  • 472.99€ / 100 microlitros
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

TMED3 Polyclonal specifically detects TMED3 in Human samples. It is validated for Western Blot.
Especificaciones

Especificaciones

TMED3
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containing 3,1200002G13Rik
Rabbit
25 kDa
100 μL
Primary
Porcine: 86%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Purified
Western Blot
1 mg/ml
Western Blot 1.0 ug/ml
Q9Y3Q3
TMED3
Synthetic peptides corresponding to TMED3(transmembrane emp24 protein transport domain containing 3) The peptide sequence was selected from the C terminal of TMED3. Peptide sequence DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS.
Protein A purified
RUO
23423
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only