missing translation for 'onlineSavingsMsg'
Learn More

Testis expressed 264 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-69517

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215303

  • 471.91€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

Testis expressed 264 Polyclonal specifically detects Testis expressed 264 in Human samples. It is validated for Western Blot.
Especificaciones

Especificaciones

Testis expressed 264
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
DKFZp451H0417, Putative secreted protein Zsig11, SIG11, testis expressed 264, testis expressed gene 264, testis expressed sequence 264, testis-expressed sequence 264 protein, ZSIG11FLJ13935
Rabbit
34 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q9Y6I9
TEX264
Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV.
Affinity purified
RUO
51368
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only