missing translation for 'onlineSavingsMsg'
Learn More

TCTA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-86497

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216366

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

TCTA Polyclonal specifically detects TCTA in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

TCTA
Polyclonal
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
T-cell leukemia translocation altered gene, T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein
Rabbit
Affinity Purified
RUO
6988
Human
IgG
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
TCTA
This antibody was developed against Recombinant Protein corresponding to amino acids:AESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKL
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only