missing translation for 'onlineSavingsMsg'
Learn More

TCF7/TCF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-58213

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18213482

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

TCF7/TCF1 Polyclonal specifically detects TCF7/TCF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

TCF7/TCF1
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box)
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
TCF7
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE
100 μL
Signal Transduction, Wnt Signaling Pathway
6932
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only