missing translation for 'onlineSavingsMsg'
Learn More

SNX10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-56466

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214742

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

SNX10 Polyclonal specifically detects SNX10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

SNX10
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
MGC33054, sorting nexin 10, sorting nexin-10
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
SNX10
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCV
100 μL
Signal Transduction
29887
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only