missing translation for 'onlineSavingsMsg'
Learn More

SLC26A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-85237

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18214257

  • 492.43€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

SLC26A4 Polyclonal specifically detects SLC26A4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Especificaciones

Especificaciones

SLC26A4
Polyclonal
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10-1:20, Immunohistochemistry-Frozen
DFNB4, EVA, PDSTDH2B, pendrin, Sodium-independent chloride/iodide transporter, Solute carrier family 26 member 4, solute carrier family 26, member 4
Rabbit
Affinity Purified
RUO
5172
Human
IgG
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
SLC26A4
This antibody was developed against Recombinant Protein corresponding to amino acids:FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK
0.1 mL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only