missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SFN (Human) Recombinant Protein

Human SFN partial ORF ( AAH00329.1, 3 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00002810-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16105641

  • 341.70€ / 10 microgramos
Envío estimado: 17-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: RASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEE
Especificaciones

Especificaciones

AAH00329.1
stratifin
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SFN
GST
2810
Wheat germ expression system
10 μg
YWHAS
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales