missing translation for 'onlineSavingsMsg'
Learn More

SEC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-55179

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215484

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

SEC6 Polyclonal specifically detects SEC6 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

SEC6
Polyclonal
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
exocyst complex component 3, Exocyst complex component Sec6, Sec 6 homolog, SEC6, SEC6L1, SEC6-like 1, SEC6-like 1 (S. cerevisiae), Sec6p
Rabbit
Affinity Purified
RUO
11336
Human
IgG
Western Blot, Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
EXOC3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMV
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only