missing translation for 'onlineSavingsMsg'
Learn More

SAP18 Recombinant Protein, Abnova

Marca:  Abnova H00010284-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16194812

  • 458.00€ / 25 microgramos


Fecha estimada de envío
23-10-2020
Añadir a la cesta

Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH30836
Solution
10284
SAP18 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SAP18
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
42.57
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY
2HOR0202|MGC27131|SAP18P
SAP18
Wheat Germ (in vitro)
GST
Videos
Documentos