missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ RPS6KC1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-54999PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215862

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KC1. Source: E.coli Amino Acid Sequence: QGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWA The RPS6KC1 Recombinant Protein Antigen is derived from E. coli. The RPS6KC1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones

Especificaciones

26750
RPS6KC1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4
EC 2.7.11.1, humS6PKh1, ribosomal protein S6 kinase delta-1, ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase, ribosomal protein S6 kinase, 52kDa, polypeptide 1, Ribosomal S6 kinase-like protein with two PSK domains 118
Unlabeled
100μL
E.coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles
Blocking/Neutralizing, Control
RPS6KC1
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51220. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For research use only.