missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ RNF149 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP1-83440PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214999

  • 242.97€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF149. The RNF149 Recombinant Protein Antigen is derived from E. coli. The RNF149 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-83440. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Especificaciones

Especificaciones

284996
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
RNF149
32kDa
0.1mL
E.Coli
LLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDESSPPSASPAESEPQCDPSFKGDAGENT
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
RNF149
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83440. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only