missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant SARS SARS MERS Protein

A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13419-1mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15923509

  • 1372.00€ / 1 miligramo


Fecha estimada de envío
16-07-2019
Añadir a la cesta

Especificaciones

Especificaciones

SARS SARS MERS Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
SARS
His
SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Videos