missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant SARS SARS MERS Protein

A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13419-100ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15913509

  • 183.00€ / 100 microgramos


Fecha de envío estimada
del proveedor 21-05-2019
Añadir a la cesta

Especificación

Especificación

SARS SARS MERS Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
SARS
His
SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Videos